Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectsmeadowtropical
Orchid Lycaste Aromatica from Orchid
Pollinators of Alaska from Nps
Iris Motif from Iris
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Disa Kewensis Orchid from Orchid
Chrysanthemum 1 from Perennial
Black Elderberry from Elderberry
Iris Flower Blossom from Iris
Double Delight Hybrid Tea Rose from Roses
Butterfly from Cartoon animals viii coloring book
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Cosmos Scabiosoides from Cosmos
Bee from Cartoon animals v coloring book
Daffodil from Daffodil
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Swallow Tail Hummingbird from Hummingbirds
Apple Blossom Branch from Apple tree
Steampunk Bee from Steampunk animals coloring book
Bumblebee from Woodland animals
Larkspur Flower from Larkspur
Black Orchid from Orchid
Rhododendron Calendulaceum or Flame Azalea from Azalea
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Hemerocallis Spp or Day Lily from Perennial
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Orchids from Orchid
Caterpillar and Buttefly from Caterpillar
Flower Poppy from Red
Europeana Floribunda Rose from Roses
American Twinflower from Celebrating wildflowers coloring book
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals viii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals v coloring book
Bumblebee from Bumblebee
Realistic Sunflowers from Sunflower
Bumblebee from Simple objects coloring book
Bee from Cartoon animals viii coloring book
Chinese Peony from Flowers
Bug from Animals
Heliconia Indica from Heliconia
Black Raspberry from Celebrating wildflowers coloring book
Common Fruit Bats from Realistic animals coloring book
Hibiscus Flower from Hawaii flower
Cherokee Rose from Roses
Butterfly from Cartoon animals vii coloring book
Spring Crocus from Crocus
Hibiscus from Realistic flowers
Hummingbird from Cartoon animals ii coloring book
Masdevallia Coccinea Orchid from Orchid
Saskatoon from Serviceberry
Grasshopper on the Flower from Grasshoppers
Renanthera Imschootiana Orchid from Orchid
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Heliconia Psittacorum from Heliconia
Aster or Star Plant from Asters
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Ranunculus Acris from Buttercup
Bluebell Bellflower from Bellflower
Scarlet Carnation from Carnation
Butterfly Flies On A Flower from Flowers
Burke's Larkspur from Celebrating wildflowers coloring book
Cornflower, Blue Bottle from Cornflowers
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper on Flower from Grasshoppers
Sophronitis Cernua Orchid from Orchid
Common Evening Primrose or Evening Star from Primrose
Sundowner Rosa Grandiflora from Roses
Aster 1 from Asters
Cornflower from Cornflowers
Grasshopper in Garden from Grasshoppers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Schlumbergera Bloom from Cactus
Cirsium Vulgare or Bull Thistle from Thistle
Aquilegia Truncata Red Columbine from Columbine
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Clarkia Amoena Farewell to Spring from Godetia
Oriental poppy from Perennial
Viola Adunca or Pale Mountain Violet from Violet
Daffodil Flowers from Daffodil
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Wildflower from Plants ii coloring book
Bug from Cartoon animals coloring book
Horse Chestnut from Chestnut
Western Blue Flax from Celebrating wildflowers coloring book
Cherry Jam Jar from Cherry
Nettle-leaved Bellflower from Bellflower
Anemone flower from Anemone
Honey Bee from Woodland animals
Marigold from Beautiful flowers coloring book
Watering Can with Flowers from Watering can
Meadow Buttercup, Ranunculus Acris from Buttercup
Butterflies and Flowers on a Meadow from Summer
Black Locust from Locust tree
201 - 300 of 1,830 Next page
/ 19